PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo21G0029600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Dof
Protein Properties Length: 251aa    MW: 26142.8 Da    PI: 7.8658
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo21G0029600genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.39.3e-402181262
           zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                     +e++l+cprCdstntkfCyynny+lsqPr+fCk CrryWtkGGalrn+PvGgg+rkn k+s
  Spipo21G0029600 21 EEQHLRCPRCDSTNTKFCYYNNYNLSQPRHFCKDCRRYWTKGGALRNIPVGGGTRKNSKRS 81
                     68999****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-261174IPR003851Zinc finger, Dof-type
PfamPF027013.5E-332379IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3292579IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102763IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MKDPSTAAFQ AAIKAPKFPQ EEQHLRCPRC DSTNTKFCYY NNYNLSQPRH FCKDCRRYWT  60
KGGALRNIPV GGGTRKNSKR SAPSSSSSSS HTKRSISSPS PAAATHAAAE AGETAAASSI  120
STIQFPKLEA IPSVYSSTDA DRQLLDFTGS FSSLLTSHGH FGSLLDSFHA GGAGVLGLPG  180
SIDMGRPIGN PSLDLHSPGD GGDMSGAPAA DAQQAPLGDN LLGLPADSSC WSGSSGWSDL  240
SIYTPGSNFQ *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP6629226e-44KP662922.1 Cajanus cajan Dof38 (Dof38) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008797869.19e-69PREDICTED: dof zinc finger protein DOF3.1-like
TrEMBLM0RLY02e-67M0RLY0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P27560_0017e-67(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.13e-35DOF zinc finger protein 1